PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g13680.1.p
Common NameBRADI_1g13680, LOC100827854
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YA
Protein Properties Length: 343aa    MW: 36570.1 Da    PI: 9.7226
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g13680.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA97.91e-30172228158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh+hA+rR+RgsgGrF
  Bradi1g13680.1.p 172 DAPIYVNAKQYEGILRRRRARAKVERENQL-VKGRKPYLHESRHRHAMRRARGSGGRF 228
                       68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-33170231IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.225171231IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-27174228IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.1E-24174196IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.1E-24205228IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MMSFKSPDGF GQVAAVTQGS HGGGAPVPWW AVSQLLYGEP AALSSPEAEA HRNGQFQGVP  60
RAQGILDPAP APPAKTAQPP AKSGAPEVLK FSVFQGNLES GGKGDKTQEH STTIALQSPL  120
PEYNSRFEFG PGQSMVSSNY PGADQCYGLL TTYTMKSMPG GRVLLPLNAP ADAPIYVNAK  180
QYEGILRRRR ARAKVERENQ LVKGRKPYLH ESRHRHAMRR ARGSGGRFLN TKKEGNGKAA  240
LGGGGSKRTD CTPPARLATS PNSVIPQSQL GNPHSRSSIS SLSGSEVSSM YDHEDVDHYN  300
SIEHLRTPFF TPLPIIMDGE HGGAAPFKWA TAADGCCELL KA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-18172234264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212221RHRHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561845.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLI1GQ010.0I1GQ01_BRADI; Uncharacterized protein
STRINGBRADI1G13680.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Representative plantOGRP51361122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.38e-26nuclear factor Y, subunit A10